Italian market festival grease pole time reddit. The Italian Market Festival is a one-of-a-kind celebration in Philadelphia’s S. TIL before the British left New York City after the Revolution, they nailed the Union Jack to a greased flagpole as a final act of defiance. . The infamous, 30-foot tallgreased pole returns to the South Ninth Street Italian Market Festival this coming weekend, May 21 and 22, after a nearly two-decade hiatus. Edit: And so it begins May 17, 2025 · 67 likes, 23 comments - lex_ascension on May 17, 2025: "Italian Market Festival Grease Pole Competition Best send of my life! #climbing #bouldering #sendit #climbinglife #southphilly #italianmarketfestival #greasepole". Read more HEATHER KHALIFA / HEATHER KHALIFA / Staff Photographer 34K likes, 36 comments - noshortsusa on May 20, 2024: "Italian Market Festival Grease Pole Climbing Challenge #philly @italianmarketphilly". May 18, 2025 · The South 9th Street Italian Market Festival brings together everything Philly does well: food, tradition, diversity, and community energy. Weeks after the Italian Market Festival, no one has taken down the cheese and meat from the greased pole Were the prizes ever at the very top of the pole or has the prize ring always been at that height? Been a long time since I was there to see it. More importantly the winning team will have bragging rights for the entire year. The Procession of Saints starts at the historic Saint Mary Magdalen de’ Pazzi Church located at 712 Montrose St. m. Best Time to Attend 389 likes, 6 comments - italianmarketphilly on May 18, 2025: "Here we go again! Our favorite Italian Market Festival tradition, the grease pole climb, is about to kick off for Day 2!". The influx of international influences on the South 9th Street Italian Market, and its surrounding neighborhood is a wonderful assault on the senses. News and happenings in and around Philadelphia, Pennsylvania. on Sunday May 18th. Festival organizers scraped it off the broiling blacktop with forks. Apr 23, 2025 · Located at the 9th & Montrose Tavolo Zona Piazza, The Grease Pole is an old tradition in which teams compete in climbing to the top of a 30-foot greased pole to reach prizes of meats, cheeses May 14, 2025 · The Italian Market Festival will once again include the Grease Pole Challenge. The Grease Pole, or Albero Della Cuccagna in Italian, is an old tradition in which teams compete in climbing to the top of a greased pole to reach prizes of meats, cheeses, gifts, and money. If anyone wanted to know what I was referring to, it's the Italian Market Annual Grease Pole Climbing Competition. encourages everyone to enjoy the festivities Thousands stepped out in the sunshine for the annual Philadelphia Italian Market Festival on Sunday for cannoli, pizza, and Aperol spritzes as they celebrated the beloved South Ninth Street Philadelphia s Italian Region Festival returned in full force over the past weekend transforming South th Street into a vibrant celebration of food heritage and public spirit As one of the city s oldest and the greater part beloved traditions the festival honors the -year legacy of the Italian Area the nation s oldest and longest-running outdoor domain and draws thousands of visitors from Jun 14, 2024 · The organizers of the Philadelphia Italian Market festival accidentally left these meats and cheeses hanging from a pole after the event ended. Join the celebration in Philadelphia's oldest outdoor market with vendors offering a variety of ethnic delicacies, entertainment, and family fun. happening at 9th and Christian, Philadelphia, PA on Sat, 17 May, 2025 at 12:00 pm EDT. The spectacle once was the centerpiece of the South Ninth Street Italian Market Festival: a 30-foot-tall beacon of steel and pig fat at Ninth and Montrose Streets, topped with meats, cheeses, and gift cards, tempting the brave, the drunk, and the temporarily insane to scramble up - and slide haplessly down. This multi-day celebration will take place on May 17th & 18th from 10 am to 5 pm on 9th Street between Wharton and Fitzwater. I went to a Polish picnic that featured a greased flagpole climb around 50 years ago. The merchants invite you to join them in this extravaganza for the senses — streets lined with vendors offering every ethnic delicacy possible, with live entertainment, fun contests and more! The Italian market festival on 9th street is this weekend and I wanted to know what places I should definitely make a trip to? Crews from the city of Philadelphia are greasing the light poles with Crisco to prevent Eagles fans from climbing after the NFC Championship Game tonight. Best Time to Attend May 17, 2025 · The Grease Pole, or Albero Della Cuccagna in Italian, is an old tradition in which teams compete in climbing to the top of a greased pole to reach prizes of meats, cheeses, gifts, and money. Perhaps even more important to the winning team Begun in the mid-to-late 1880s, the South 9th Street Shopping District runs along 9th Street from Wharton to Fitzwater Streets. The pole is 30 feet high, greased with lard, and you will find it at the 9th & Montrose Piazza! Grease Pole Climbing Competition at Philly's 9th Street Italian Market Festival [Olympus OM-1, 35mm, Ilford HP5 400] an Italian festival where people climb greased poles to get meat I, too, watched Caligula. Best Time to Attend The Grease Pole, or Albero Della Cuccagna in Italian, is an old tradition in which teams compete in climbing to the top of a greased pole to reach prizes of meats, cheeses, gifts, and money. May 20, 2022 · Can anyone climb the Italian Market Festival's greased pole this year? Jenn is in South Philly finding out the secrets to successfully climbing the greased pole! TOMORROW! 🎉🇮🇹 The South 9th Street Italian Market Festival returns May 17th &18th, and it all starts at 10 AM! This iconic Philly tradition takes over South 9th Street all weekend long with nonstop food, music, and community vibes. About Press Copyright Contact us Creators Advertise Developers Terms Privacy Policy & Safety How YouTube works Test new features NFL Sunday Ticket © 2025 Google LLC May 12, 2023 · Philly's largest Block Party, The Italian Market Festival is a two-day event held in Philadelphia's South 9th Street Italian Market. May 21, 2023 · The South 9th Street Italian Market Festival runs Saturday and Sunday and will feature plenty of food and a greased pole climbing competition. In this event, participants form human pyramids as they climb up a lard-covered pole in their attempt to reach cheeses and meats at the top. 494K subscribers in the philadelphia community. May 13, 2025 · Join South Philly’s Italian Market Festival May 17–18 for two days of food, music, cultural traditions, and family fun along historic South 9th Street. May 18, 2025 · The greased pole-climbing competition is the festival’s most popular event as hundreds cheer on teams of intrepid climbers. May 13, 2024 · A group of men with Pace Roofing LLC compete in the grease pole contest at the South 9th Street Italian Market Festival in Philadelphia on Saturday, May 21, 2022. 42 votes, 20 comments. More specifically, it is the name of several events that involve staying on, climbing up, walking over or otherwise traversing such a pole. and 3:30 p. May 20, 2016 · Time to get your hands greasy. The grease pole, or albero della cuccagna in italian, is an old tradition in which teams compete in climbing to the top of a greased pole to reach prizes of meats, cheeses, gifts,. May 16, 2025 · The 2025 South 9th Street Italian Market Festival returns this weekend with lots of vendors and tons of family fun, but mostly lots of tasty food and one greased pole ready for climbing. This won't stop people from attempting to climb-as a matter of fact some people may use this as an opportunity to train for the summertime Italian Street Festival off South St, where there is competitive grease pole climbing. They did it for decades during this Italian Festival on 9th Street every May. Ideally under 30. between 9th & 10th). Italian market festival grease pole climb Credit: @lex_ascension on IGSubscribe for more Awesome Videos :)#shorts #viralshorts The Details: Bring the entire family and enjoy all the festival events, including live musical entertainment, arts and crafts, Grease Pole contest, 12th Annual John Marzano Halfball Tournament, Cornhole At The Festival, the traditional Procession of Saints, and so much delicious food throughout the market. 523 votes, 39 comments. The procession starts at Saint Mary Magdalen de' Pazzi Church at 712 Montrose St. The imported cheese plopped down in gooey strands. 9th Street Italian Market – the nation’s oldest outdoor market. May 16, 2024 · When’s the best time to watch? The pole climb is on both Saturday and Sunday, at 1:30 p. Jun 24, 2016 · Climbing a greased pole, or Albero della Cuccagna to Italian speakers, is the centerpiece of the annual Italian Market Festival that runs from Fitzwater to Wharton streets on Ninth Street Saturday and Sunday. Teams can register on-site day of the event. The city of brotherly love 😘. From Longo’s experience, Saturday’s climbers tend to be the tourists and new climbers, Hijacking this post to brag that my friend's fiance and his bros were some of the gentlemen to successfully climb the grease pole! Fiance was one of the base dudes so mad respect. The smell of herbs and spices, fresh seafood , and ground coffee beans mingles perfectly with the crackle of the butcher’s brown paper, multiple languages heard on the street, and the sight of fresh sheets of pasta and silky ribbons of homemade Feb 1, 2018 · In May, Philadelphia's Italian Market Festival will welcome aspiring climbers to conquer the grease pole. Pausing for the Blessing of the Market at 9th and Washington, the procession then proceeds along S. Expect shoulder to shoulder crowds. Where teams compete to grab a prize, like salami Jun 27, 2025 · Here's a look back at 2024's Greasy Pole competition in anticipation of the weekend festivities. Shots I took of the Grease Pole Climbing Competition at the 2024 9th Street Italian Market Festival Climbing a greased pole is a worldwide tradition. Bring the entire family to experience the Procession of Saints, and to enjoy the traditional Half Ball Tournament, Grease Pole contest, Live Entertainment stages, Family Events areas, Crafts, Food, Food, and more Food! 516 likes, 14 comments - italianmarketphilly on April 24, 2023: "Think you have what it takes to climb to the top? Join the excitement of the Grease Pole Climbing Contest at the Italian Market Festival in Philly! 📸: @katkuo_design #ItalianMarketFestival #PhillyPride #HalfBallTournament #CommunityCelebration #FoodieFun #FriendlyCompetition #CityOfBrotherlyLove #Tradition # Experience the annual South 9th Street Italian Market Festival with live music, arts and crafts, Grease Pole contest, and delicious food. They stayed there for a month, much to the annoyance May 13, 2024 · A group of men with Pace Roofing LLC compete in the grease pole contest at the South 9th Street Italian Market Festival in Philadelphia on Saturday, May 21, 2022. Visitors can enjoy many festival events, including live music, arts and crafts, a Grease Pole contest, and food throughout the market. May 12, 2023 · Philly's largest Block Party, The Italian Market Festival is a two-day event held in Philadelphia's South 9th Street Italian Market. The festival features live music, food vendors, arts and crafts, and a grease pole climbing competition. Hey, my sister in law helped bring back the grease pole (she produces the Italian Market Festival). Best Time to Attend May 18, 2025 · 389 likes, 6 comments - italianmarketphilly on May 18, 2025: "Here we go again! Our favorite Italian Market Festival tradition, the grease pole climb, is about to kick off for Day 2!". Reenacting the feat became a holiday celebration : r/todayilearned Gaming Sports Business Crypto Television Celebrity Go to 1,512 likes, 15 comments - italianmarketphilly on May 17, 2025: "Our first successful grease pole climbers at the festival! @paceroofing with some help from the Chili Group got the job done 💪 The Climb continues today and tomorrow!". 498K subscribers in the philadelphia community. May 19, 2023 · It was so sizzling hot at last year’s Italian Market Festival that the prized plump provolone balls dangling atop the Grease Pole melted. 9th to Christian Street, and concludes at St. Apr 9, 2025 · What happened: Philly's Italian Market Instagram page recently posted that the pole-climbing competition at this year's festival was ditching the grease for tomato sauce. Wait, people actually climb it? I thought it was basically a joke that no one could 😂. Though I'm getting PMs informing me there are other events like this! Philadelphia has a strong Italian heritage that seems to translate into pole climbing because of our cultural background The Italian market in philly has had a tradition for years where meats and cheese were kept at the top for the lucky few were climbed to the top. Feb 7, 2025 · Forever tied to the greatest moment in Philadelphia sports history, pole climbing enshrined itself in the city’s culture and “grease the poles” became a rallying cry uttered whenever a Philly team nears a championship. It's a bit amusing that the first must haves from the Italian market festival suggestions are Mexican foods and Mexican/Caribbean drinks. , where status of Christian saints are carried through the market. There are also pictures of people climbing the poles for the Flyers parade in 74. This area, just south of Center City Philadelphia, has always been a multicultural and vibrant mix of people and businesses. Here’s what to eat and see, plus how to navigate the city’s biggest Italian fest. Woo! Congratulations. Grease pole usually really gets going later in the day, and is worth watching some attempts at, someone usually gets to the top. Best Time to Attend 35 Likes, TikTok video from Cosimo Lobello (@cosimolobello): “Join us at the Italian Market Festival for the exciting Grease Pole Climb! Will they make it to the top? Discover festivities in Philly! #italianmarketphilly #italianmarketfestivalphiladephia”. Yeah but imagining a bunch of guys from philly doing it is probably funnier than anywhere else. Grease pole climb YO! u dont even need to put grease on it they already can provide as much grease as ya need. Procession of Saints: This event has been part of the festival's cultural identity for years. com Open 19 0 Share Add a Comment This is from the annual grease pole climbing competition at the Italian Market Festival in Philadelphia, PA. More than anything, come hungry. Apr 29, 2024 · April 29, 2024 Celebrate 110 years of culture at the S. May 16, 2024 · The 2024 South 9th Street Italian Market Festival returns this weekend with lots of vendors and tons of family fun, but mostly lots of tasty food and one greased pole ready for climbing. May 20, 2018 · Everyone is Italian on May 19 & 20, when the nation's oldest outdoor market celebrates its annual Italian Market Festival. 196 likes, 0 comments - italianmarketphilly on April 28, 2024: "GREASE THE POLE! We're less than a month away from the best weekend of the year. Perhaps even more important to the winning team are the bragging rights… until next year. May 21, 2018 · The grease pole tradition continued on Sunday in South Philadelphia, but this time in a sanctioned competition at the annual 9th Street Italian Market Festival. One American managed to scale the pole with nails and cleats and replace the flag with the Stars and Stripes. There are Philadelphians who have been training for this situation. Greasy pole, grease pole, or greased pole refers to a tall pole that has been made slippery with grease or other lubricants and thus difficult to grip. The annual Italian Market Festival is held in one of Philadelphia’s most established neighborhoods—the stretch of South Ninth Street in South Philadelphia, now known as the 9th Street Italian Market. 418 votes, 23 comments. Italian Market Festival celebrates heart and soul of South Philly, Pete italian fest on saturday, april 27th promises a delightful time for all. The Grease Pole 30 feet high, greased with lard, located at the 9th & Montrose Piazza, teams will compete both Festival Days for prizes of meats, cheeses, gift cards and money, hanging from the top of the pole. Philadelphia Injury Lawyers, P. The Italian Market pole climbing started in the 60s I think. 9th Street Italian Market Festival Philly's largest block party returns on Saturday, May 18 and Sunday, May 19 We would like to show you a description here but the site won’t allow us. But the real centerpiece, the heart-pounding spectacle that drew thousands, was the legendary Grease Pole Competition. They won on their second attempt to climb the pole and grab the meat and cheese hanging on top. After the Italian Market Festival there were bundles of cheese and meat hanging from the grease poles. Philly “Crisco Cops” are greasing the light poles to prevent Eagles fans from climbing them after the NFC Championship game tonight. In honor of it finally being festival month, we're throwing it back this Thursday to a few photos of South 9th Street legend Frankie Longo making the grease pole climb May 17, 2025 · This Weekend The Italian Market Festival Is Back With Over 100+ Vendors, Food, Fun, and Greased Poles This weekend, head to South Philly for the Italian Market Festival—a vibrant celebration of food, culture, and community! A group of Philadelphians attempt to climb a pole greased in pig fat, as part of an annual ritual during a multicultural festival along Ninth Mar 20, 2025 · The 9th Street Italian Market Festival returns for two days of music, fun, and of course food. The once-absurd act had become a citywide ritual of civic pride and sports fanaticism. Paul Catholic Church (808 S. Get ready for the legendary grease pole climbing competition, live bands on multiple stages, DJs, family-friendly fun, and some of the best Italian (and 2 likes, 0 comments - 3gotravel on May 25, 2023: "What a fun highlight at the Italian Market Festival in Philadelphia. It doesn't help that there's a tradition in South Philly for the Italian Market Festival where people climb a greased pole. Register or Buy Tickets, Price information. Whether you’re coming for the cannoli or the grease pole, it’s a weekend full of local flavor and shared experience. Be at least under 38 years old. Over 200 active businesses (open daily) host one million visitors a year across Jul 14, 2025 · The scent of traditional Italian food wafted through the air — sausage and peppers, cannoli, espresso, fresh zeppole — as families gathered, music played, and laughter echoed across the festival grounds. Italian Market Festival Grease Pole Contest Reply TwiistedTwiice • Jets • Additional comment actions Feb 20, 2025 · Grease Pole Climbing Competition: Watch as teams go head-to-head in competition to climb a 30-foot pole greased with lard. If you’re cool with that, then you’re good. Mark your calendars May 18th & 19th for the South 9th Street Italian Market Festival. “Do you know what the temperature had Feb 20, 2025 · Grease Pole Climbing Competition: Watch as teams go head-to-head in competition to climb a 30-foot pole greased with lard. May 19, 2025 · Philadelphia’s Italian Market Festival returned in full force over the past weekend, transforming South 9th Street into a vibrant celebration of food, culture, and community spirit. The festival originated in 1971, and was revived for 2001 with a Nov 5, 2022 · Frankie Longo, a former champion and legend of the South 9th Street Italian Market Festival’s annual grease pole climbing competition, sees novices overestimating their core strength. In 20 years going and 12 or so years actually participating Ive only seen it beaten 4 times. Today, while the outdoor vendors and many of the original Italian businesses remain, the market has diversified with new waves of immigration, providing a well-rounded shopping experience. Italian Market Festival 2024: Food, schedule, road closures, parking, and more [this weekend] : r/philadelphia r/philadelphia Current search is within r/philadelphia Remove r/philadelphia filter and expand search to all of Reddit May 18, 2019 · Located at the 9th & Montrose Tavolo Zona Piazza, The Grease Pole 30 feet high, greased with lard, teams will compete both Festival Days for prizes of meats, cheeses, gift cards and money, hanging from the top of the pole. Did they just have all the peeps coming out of Geno's and Pats wipe their hands on the pole on their way out or somethin? Feb 20, 2025 · Grease Pole Climbing Competition: Watch as teams go head-to-head in competition to climb a 30-foot pole greased with lard. May 15, 2025 · A greased pole climbing competition, meatballs, half ball, gelato, tacos and more! The 9th street fest is back with a bang. Hutchinson, on Christian St. Attempting to climb the grease pole! The Grease Pole, or Albero Della Cuccagna in Italian, is an old tradition in which teams compete in climbing to the top of a greased pole to reach prizes of meats, cheeses, gifts, and money. Back To Main Site Events Entertainment Grease Pole Climbing Halfball Procession of Saints Vendors May 14, 2025 · Each year, Philly's South Ninth Street Italian Market Festival features more than 100 vendors lining the streets and includes several can't-miss events, including the greased-pole climbing competition. Things will be a little different this time, though: There will be liability waivers Weeks after the Italian Market Festival, no one has taken down the cheese and meat from the greased pole inquirer. Feb 20, 2025 · Grease Pole Climbing Competition: Watch as teams go head-to-head in competition to climb a 30-foot pole greased with lard. Can confirm. C. Join us for the 2 day party featuring live music & entertainment, kids activities, tons of street vendors, delicious food, cold drinks, greased poles & a great time Dec 5, 2023 · This year, they're holding an Italian Market Festival on May 18 and May 19. Check back for start time. May 17, 2025 · Find tickets & information for Italian Market Festival John Marzano Half Ball Tournament. Feb 18, 2025 · The Italian Market Festival brings food, music, and traditions to South Philly. 450K subscribers in the philadelphia community. For over 100 years, Philadelphia's S. xcv xvmvy hbvrf wqfb sig axuuh wdrbj wrpmo juszzf fxqiktrqs